PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02349.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 300aa    MW: 33238 Da    PI: 8.5727
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02349.1_g00008.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.71.9e-52141391128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrF Ptdeel+v+yL++kv+g +++l +vi ++d+yk++PwdLp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkat
  Rsa1.0_02349.1_g00008.1  14 LPPGFRFYPTDEELLVQYLCRKVAGYHFSL-QVIGDIDLYKFDPWDLPSKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKAT 98 
                              79***************************9.99***************8777899******************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk ++s +g+ vg+kk Lvfy g+apkg+kt+W+mheyrl
  Rsa1.0_02349.1_g00008.1  99 GTDKIITS-DGHRVGIKKALVFYAGKAPKGTKTNWIMHEYRL 139
                              ****9999.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-678162IPR003441NAC domain
PROSITE profilePS5100560.77314162IPR003441NAC domain
PfamPF023656.2E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MGVREMDPLA QLSLPPGFRF YPTDEELLVQ YLCRKVAGYH FSLQVIGDID LYKFDPWDLP  60
SKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITSDGHR VGIKKALVFY  120
AGKAPKGTKT NWIMHEYRLF EHSRSHGSSK LDDWVLCRIY KKTSGSQRQQ AVAPVQPEHS  180
TNGSSSSSSS HHEDVLDSFP EMKDRSFDLP RVNSLRTLLN GNFDWASLAG LNPIPELAPA  240
SSGYGGGGYD AFRAAEGEAE SGLRNSQMNS SGLTQSFGYS SSGLSSGGFG PSGQTYEFRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-10711687174NAC domain-containing protein 19
3swm_B1e-10711687174NAC domain-containing protein 19
3swm_C1e-10711687174NAC domain-containing protein 19
3swm_D1e-10711687174NAC domain-containing protein 19
3swp_A1e-10711687174NAC domain-containing protein 19
3swp_B1e-10711687174NAC domain-containing protein 19
3swp_C1e-10711687174NAC domain-containing protein 19
3swp_D1e-10711687174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7158530.0KF715853.1 Brassica oleracea var. italica NAC-domain protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009137656.10.0PREDICTED: NAC domain-containing protein 72
SwissprotQ93VY30.0NAC72_ARATH; NAC domain-containing protein 72
TrEMBLA0A078GWD90.0A0A078GWD9_BRANA; BnaA03g48570D protein
STRINGBra019052.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-176NAC family protein